Protein coding transcript 218719

• Transcript: Ll_transcript_85005
• CDS coordinates: 593-1009 (+)
• Peptide sequence: MQIHVFKRPATLTRPLIFCISILSLFFVVIALFKDIPDMEGDTKFGIQSLSTRLGQKWVFWICISLLEMAYGFTILAGATSPFIWSKISTGMGHAILASVLWYHAKYVDLKSNVALQSFYMFIWKLLWAEYFLIPLFR*
• ORF Type: complete

Annotations of Ll_transcript_85005

• Blastp: Naringenin 8-dimethylallyltransferase 1, chloroplastic from Sophora with 76.81% of identity
• Blastx: Naringenin 8-dimethylallyltransferase 2, chloroplastic from Sophora with 70.92% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419929.1)
• Pfam: UbiA prenyltransferase family (PF01040.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;