Protein coding transcript 218752

• Transcript: Ll_transcript_84055
• CDS coordinates: 91-840 (+)
• Peptide sequence: MTTVVPTSDEDPALSVFRFVSDLSWADAGPEVAEPQVTRLCLEAEEFIALGKWLELANLMVPSAEVIFSKVPEKDVESIFTIICNLVTKTENPDEALEIVKVIIPEKPIQPQIEKPAVRLKIWMNLYNLLETPHSRFYVYKKALELAVVGKVTEYILPSFKKIDSFLKDWKIGIPDQRELFLTISNILKDNKSTTKDSFKFLTNYLATFNGEDAHVLEKAKEGAVRAIVEFVKALDLFQVPCVILKLND*
• ORF Type: complete

Annotations of Ll_transcript_84055

• Blastp: Eukaryotic translation initiation factor 3 subunit M from Dictyostelium with 31.91% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit M from Dictyostelium with 31.91% of identity
• Eggnog: formation of translation preinitiation complex(ENOG410XNP7)
• Kegg: Link to kegg annotations (DDB_G0287005)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442748.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;