Protein coding transcript 218755

• Transcript: Ll_transcript_84041
• CDS coordinates: 91-1182 (+)
• Peptide sequence: MTTVVPTSDEDPALSVFRFVSDLSWADAGPEVAEPQVTRLCLEAEEFIALGKWLELANLMVPSAEVIFSKVPEKDVESIFTIICNLVTKTENPDEALEIVKVIIPEKPIQPQIEKPAVRLKIWMNLYNLLETPHSRFYVYKKALELAVVGKVTEYILPSFKKIDSFLKDWKIGIPDQRELFLTISNILKDNKSTTKDSFKFLTNYLATFNGEDAHVLEKAKEGAVRAIVEFVKALDLFQCDLLDLPAVGQLEKDAEYSSLYQLLKIFLTQRLDVYLAFQSANSTLLKSYGLVHEECVAKMRLLSLVDLSSDGSAQIPYELIKDTLQITDDEVELWVVKAITAKLIVGKIDQMNQVVIVRYVCQ*
• ORF Type: complete

Annotations of Ll_transcript_84041

• Blastp: Eukaryotic translation initiation factor 3 subunit M from Dictyostelium with 37.14% of identity
• Blastx: Eukaryotic translation initiation factor 3 subunit M from Dictyostelium with 36.83% of identity
• Eggnog: formation of translation preinitiation complex(ENOG410XNP7)
• Kegg: Link to kegg annotations (DDB_G0287005)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442748.1)
• Pfam: PCI domain (PF01399.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;