Transcript | Ll_transcript_84045 |
---|---|
CDS coordinates | 1114-2028 (+) |
Peptide sequence | MVPSAEVIFSKVPEKDVESIFTIICNLVTKTENPDEALEIVKVIIPEKPIQPQIEKPAVRLKIWMNLYNLLETPHSRFYVYKKALELAVVGKVTEYILPSFKKIDSFLKDWKIGIPDQRELFLTISNILKDNKSTTKDSFKFLTNYLATFNGEDAHVLEKAKEGAVRAIVEFVKALDLFQCDLLDLPAVGQLEKDAEYSSLYQLLKIFLTQRLDVYLAFQSANSTLLKSYGLVHEECVAKMRLLSLVDLSSDGSAQIPYELIKDTLQITDDEVELWVVKAITAKLIVGKIDQMNQVVIVRYVCQ* |
ORF Type | complete |
Blastp | Eukaryotic translation initiation factor 3 subunit M from Dictyostelium with 38.13% of identity |
---|---|
Blastx | Eukaryotic translation initiation factor 3 subunit M from Dictyostelium with 36.83% of identity |
Eggnog | formation of translation preinitiation complex(ENOG410XNP7) |
Kegg | Link to kegg annotations (DDB_G0287005) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442748.1) |
Pfam | PCI domain (PF01399.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer