Transcript | Ll_transcript_83225 |
---|---|
CDS coordinates | 339-821 (+) |
Peptide sequence | MKGVMAMASQKVGEFTKDNPSWKSDNWQQNENNRNGLYQEYNQENSGWNSSSRGGQPSSVGQTNTYHSNSSDDWGLKDSRKEELAKGSSPQSSNTRNSSSWDDWDHEYPVKKEPAKGPASHTSDAWAGWDDGFDSRNASNNKTVGHNGKSDSAWTGGGFH* |
ORF Type | complete |
Blastp | Probable ADP-ribosylation factor GTPase-activating protein AGD6 from Arabidopsis with 40.36% of identity |
---|---|
Blastx | Probable ADP-ribosylation factor GTPase-activating protein AGD6 from Arabidopsis with 48.53% of identity |
Eggnog | domain, ankyrin repeat and PH domain(COG5347) |
Kegg | Link to kegg annotations (AT3G53710) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425865.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer