Protein coding transcript 21882

• Transcript: Ll_transcript_320420
• CDS coordinates: 173-580 (+)
• Peptide sequence: MQYISSLFNFGYVHVGTCRVSPDHNYLAYTLDISGGERFMLQVKDLRSGLADPKLEVDDVVSLAWAQDASSLFYTLSDENQRPYRVLCKKLGSEYVNDFPVFTESDSSFCVDITSTKDGLYYRFGQSNGWFTKNL*
• ORF Type: complete

Annotations of Ll_transcript_320420

• Blastp: Protease 2 from Moraxella with 33.04% of identity
• Blastx: Protease 2 from Moraxella with 33.04% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462191.1)
• Pfam: Prolyl oligopeptidase, N-terminal beta-propeller domain (PF02897.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;