Protein coding transcript 218836

• Transcript: Ll_transcript_83909
• CDS coordinates: 223-666 (+)
• Peptide sequence: MEDRTVGIGGASFVAVRKIPHGEPCHSNSAEVVAGSAAWLGKGLSCVCVQKRDSDASTFFDLTLAQEECLERLQRRIDVPYDSSITEHQDALRALWNAAFPGEELRGLISEQWKEMGWQGKDPSTDFRGGGFISLENFLYFSRNFPV*
• ORF Type: complete

Annotations of Ll_transcript_83909

• Blastp: ELMO domain-containing protein 2 from Homo with 50% of identity
• Blastx: ELMO domain-containing protein 2 from Homo with 50% of identity
• Eggnog: ELMO CED-12 domain containing(ENOG410XRXC)
• Kegg: Link to kegg annotations (255520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464704.1)
• Pfam: ELMO/CED-12 family (PF04727.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;