Protein coding transcript 21884

• Transcript: Ll_transcript_320422
• CDS coordinates: 683-1540 (+)
• Peptide sequence: MDGLQRICKRTSGVQYFVEHHSGLFYILTNAPIPDGQWFGEDYYLVRCRVEDIQSAKWETTILPDNNMSICDMDIFNGHLVLSLKKKGLPLLCSVDILIQIDLKHQIYIQDLKPWYFPMPSNACSVVPGSNHDFLNDVYRVVLSSPVMPDVIVDYDMSRQTYSIVHQEEVICDSVRQSCTQSFQLSTIEAQELPIDKKECPRNSGSQIWNEFSEVFCCQREEVISHDGVRVPLTIVYSRESWRKGLSPGLLVGYGAYGEDLDKSWCSERLSLLERGWVVAFADVR*
• ORF Type: complete

Annotations of Ll_transcript_320422

• Blastp: Protease 2 from Escherichia with 26.07% of identity
• Blastx: Protease 2 from Moraxella with 25.56% of identity
• Eggnog: Oligopeptidase b(COG1770)
• Kegg: Link to kegg annotations (JW1834)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462191.1)
• Pfam: Prolyl oligopeptidase, N-terminal beta-propeller domain (PF02897.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;