Protein coding transcript 218892

• Transcript: Ll_transcript_85980
• CDS coordinates: 298-960 (+)
• Peptide sequence: MMSKFPITFSMKHFLVVSLALNVSLILRIIYDNEDGPSKYMGLKKTTMSQYDAKSRREVSIIHHLRLSASTLANSSTCSDHPEDRDRIINLDHGDPKMYEKFWRKMGDKSTITIPGWQSISYFSDITNICWFLEPELAKEVVRLHNVVGNAVTKGRYIVVGTGSSQLILAAFYALSPPDAPEPISVLSASPYYSVTTHKLLEIKEQENDFILTQNNKNIF*
• ORF Type: complete

Annotations of Ll_transcript_85980

• Blastp: Tryptophan aminotransferase-related protein 2 from Arabidopsis with 51.02% of identity
• Blastx: Tryptophan aminotransferase-related protein 2 from Arabidopsis with 51.02% of identity
• Eggnog: tryptophan aminotransferase-related protein 2-like(ENOG410YMNS)
• Kegg: Link to kegg annotations (AT4G24670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463890.1)
• Pfam: Allinase (PF04864.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;