Transcript | Ll_transcript_85956 |
---|---|
CDS coordinates | 2173-2778 (+) |
Peptide sequence | MTDFQKSGLYKWGGDAKSFDKDGPYIELVTSPNNPDGHTRQPVVNRSDGILIHDLAYYWPHYTPISSPSDHDITLFTVSKSTGHAGMRIGWALVKDQEVAKRMTKFIELNTIGVSKDSQLRAAKVLKLVSDSTEQENTQELSFFNYSYEIMEQRWKQLRASAEANGLFTLPNFPTEFCTFFNKETENLPAFAWMKCEKDIED |
ORF Type | 3prime_partial |
Blastp | Tryptophan aminotransferase-related protein 2 from Arabidopsis with 64.36% of identity |
---|---|
Blastx | Tryptophan aminotransferase-related protein 2 from Arabidopsis with 64.08% of identity |
Eggnog | tryptophan aminotransferase-related protein 2-like(ENOG410YMNS) |
Kegg | Link to kegg annotations (AT4G24670) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463890.1) |
Pfam | Allinase (PF04864.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer