Protein coding transcript 218959

• Transcript: Ll_transcript_84143
• CDS coordinates: 444-1178 (+)
• Peptide sequence: MMEGDKYIQASSKGKNVESLSSSSELQHQNPRKKKNKIENKRRFSDEQIRSLECIFESESKLEPRKKLQLATDLGLQPRQVAIWFQNRRARWKSKRMEQEYRKLRDEYDNLASRFESLKNEKESLQLELQKLSDLMRESHEVKVAKENSTEDGVSGSGYNNWRVEMKPSFSNEGLEEIEGMHYSDDQNEKSIRSEKSEEIGKQVLRMDEHEEIPLPLLEKWYNVDPSGILDQSCSSSQWLDLWT*
• ORF Type: complete

Annotations of Ll_transcript_84143

• Blastp: Homeobox-leucine zipper protein ATHB-7 from Arabidopsis with 39.33% of identity
• Blastx: Homeobox-leucine zipper protein ATHB-7 from Arabidopsis with 76.39% of identity
• Eggnog: homeobox-leucine zipper protein(ENOG410Z2UE)
• Kegg: Link to kegg annotations (AT2G46680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433935.1)
• Pfam: Homeobox domain (PF00046.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;