Protein coding transcript 219010

• Transcript: Ll_transcript_85376
• CDS coordinates: 570-1022 (+)
• Peptide sequence: MWKAECQKMVPVIGSGKFITTPLLGDDGKPIDPSLVGISTSDNKVLQWLQVLHQIGLDVVRTDRALAFYETEANQAKLWDVLAVFAWLNSETGYVQGMNDICSPLIILIENEADCFWCFERAMRRLLWRLEEAWVGVSLAPEILFHRRII*
• ORF Type: complete

Annotations of Ll_transcript_85376

• Blastp: TBC1 domain family member 15 from Mus with 42.35% of identity
• Blastx: TBC1 domain family member 15 from Mus with 30.34% of identity
• Eggnog: TBC1 domain family member(COG5210)
• Kegg: Link to kegg annotations (66687)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433050.1)
• Pfam: Rab-GTPase-TBC domain (PF00566.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;