Protein coding transcript 219016

• Transcript: Ll_transcript_85385
• CDS coordinates: 238-840 (+)
• Peptide sequence: MIGCGGFWRKVFMMSSGATELNTFYPIRPECQSDVPPTRFKPRAGKTLSARRWHASFSADGRLNIAKVLRRIQRGGVHPSIKGVVWEFLLGCYDPNSTFDERNELMQRRRGQYDMWKAECQKMVPAIGSGKFITTPLVGDDGKPTDPSLIGVSTSDKKVLQWMQVLHQIGMHMQLLRYWIHIIVLTDYSFVLQFFLLGLH*
• ORF Type: complete

Annotations of Ll_transcript_85385

• Blastp: TBC1 domain family member 25 from Mus with 35.45% of identity
• Blastx: TBC1 domain family member 25 from Mus with 35.78% of identity
• Eggnog: TBC1 domain family member(COG5210)
• Kegg: Link to kegg annotations (209815)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459238.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;