Transcript | Ll_transcript_319233 |
---|---|
CDS coordinates | 25-396 (+) |
Peptide sequence | MWSWKIGPAIATGNTVVLKTAEQTPLSAYIACKLIQEAGFPPGVINVITGFGKIAGAAMSAHMDIDKIAFTGSTVVGRQIMKSAAGSNLKKVTLELGGKSPNIVFADADLDEAIHWVNFGIYFN |
ORF Type | 3prime_partial |
Blastp | Aldehyde dehydrogenase from Alternaria alternata group with 100% of identity |
---|---|
Blastx | Aldehyde dehydrogenase from Alternaria alternata group with 100% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020217837.1) |
Pfam | Aldehyde dehydrogenase family (PF00171.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer