Protein coding transcript 21907

• Transcript: Ll_transcript_319236
• CDS coordinates: 1-438 (+)
• Peptide sequence: NYIRKEPIGVCGQIIPWNFPILMWSWKIGPAIATGNTVVIKTAEQTPLSAYVACKLIQEAGFPPGVINVITGFGKVAGAAISAHMDVDKVAFTGSTVVGRQIMKAAAGSNLKKVTLELGGKSPNIVFADADLDEAIHWVNFGIYFN
• ORF Type: internal

Annotations of Ll_transcript_319236

• Blastp: Aldehyde dehydrogenase from Alternaria alternata group with 95.21% of identity
• Blastx: Aldehyde dehydrogenase from Alternaria alternata group with 95.21% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020217837.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;