Protein coding transcript 219093

• Transcript: Ll_transcript_83389
• CDS coordinates: 128-685 (+)
• Peptide sequence: MFVSLFTFQNEWVICRVFQKSLSGEKIHISGIMKLNSYGNEFGSYVLPPTPMNDSVYVPCFSNPIDNVQRNNNQGGIFDPFTNPTYGVLSSPLQFSPTKVPPQTVTASFYTSTQGFHQVPANLPLHGSVYNMQDHTMMRNLYDNNNNGLKSDREMVNLSQETCLTTDMNGETSSVLSNFDGLWNY*
• ORF Type: complete

Annotations of Ll_transcript_83389

• Blastp: NAC domain-containing protein 100 from Arabidopsis with 31.89% of identity
• Blastx: NAC domain-containing protein 100 from Arabidopsis with 31.89% of identity
• Eggnog: NAC domain-containing protein(ENOG410Y9QZ)
• Kegg: Link to kegg annotations (AT5G61430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451347.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;