Protein coding transcript 219202

• Transcript: Ll_transcript_83527
• CDS coordinates: 1-297 (+)
• Peptide sequence: ANSEKARVKVNVRLNLHGIVSIESATLIEEEETEVLVSKEPAGENTKMETDDVAAAAAAPVAENGLPETGDKPVQMDIDTKVEAPKKKVKKTNISVSEL
• ORF Type: internal

Annotations of Ll_transcript_83527

• Blastp: Heat shock 70 kDa protein 14 from Arabidopsis with 53.39% of identity
• Blastx: Heat shock 70 kDa protein 15 from Arabidopsis with 50.43% of identity
• Eggnog: Heat shock protein(COG0443)
• Kegg: Link to kegg annotations (AT1G79930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436423.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;