Protein coding transcript 219211

• Transcript: Ll_transcript_83547
• CDS coordinates: 1314-1940 (+)
• Peptide sequence: MRNTTRTRVGEIVEVEGGHIVRSTGRKDRHSKVCTAKGPRDRRVRLSAHTAIQFYDVQDRLGYDRPSKAVDWLITKAKAAIDKLAELPAWNPTTTTNYQQINEILHRHPPAVEDVIIGCGGGRMSEEFQHQQQQEEEDFAEENNNSNKYNSVGSGFLPLSMDTDIVDTIKSFFPTVAAAETTASFHTISKPTSAAANHNHQEDLRLSLQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_83547

• Blastp: Transcription factor TCP3 from Arabidopsis with 56.44% of identity
• Blastx: Transcription factor TCP4 from Arabidopsis with 52.15% of identity
• Eggnog: Transcription factor(ENOG410YG88)
• Kegg: Link to kegg annotations (AT1G53230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449183.1)
• Pfam: TCP family transcription factor (PF03634.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;