Protein coding transcript 219238

• Transcript: Ll_transcript_84630
• CDS coordinates: 95-721 (+)
• Peptide sequence: MAEVMLLIDDLELLSGISRCRICHEEDFENSSSNMESPCACSGTIKFAHRDCIQRWCNEKGNTICEICLQQYEPGYIAPPKILEKTDEAMSIRREEEESNMRIEERVEGVVIESECSYAADRTASRCRSLALSFTILLLVRHLFSTCTNGTEHYPFSMLTVIMLKASGIIIPMYIIIRIIGAIQNSIQHHYQDYYYNRSISVGDEENR*
• ORF Type: complete

Annotations of Ll_transcript_84630

• Blastp: E3 ubiquitin-protein ligase MARCH1 from Mus with 25.81% of identity
• Blastx: Probable E3 ubiquitin ligase SUD1 from Arabidopsis with 37.31% of identity
• Eggnog: (Membrane-Associated Ring finger (C3HC4))(COG5183)
• Kegg: Link to kegg annotations (72925)
• CantataDB: Link to cantataDB annotations (CNT0000623)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430685.1)
• Pfam: RING-variant domain (PF12906.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;