Protein coding transcript 219268

• Transcript: Ll_transcript_83856
• CDS coordinates: 625-1065 (+)
• Peptide sequence: MDAKKLLSLEPRTWDFISRLEPKVGLVEHVLDRRDFGDLMSIIRDCKENKESVVKGENGHSILSGLHHIQTAKKPKIAVVGSGPSGLFASLVLAEFGADVTLIERGQAVEKRGRDIGALVVRRILELESNFCFGEVVLCISIYFFD*
• ORF Type: complete

Annotations of Ll_transcript_83856

• Blastp: Uncharacterized protein Cbei_0202 from Clostridium with 42.67% of identity
• Blastx: Uncharacterized protein Cbei_0202 from Clostridium with 30.5% of identity
• Eggnog: fad dependent oxidoreductase(COG2509)
• Kegg: Link to kegg annotations (Cbei_0202)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417179.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase (PF07992.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;