Protein coding transcript 219334

• Transcript: Ll_transcript_85774
• CDS coordinates: 334-903 (+)
• Peptide sequence: MDLDHDASISSLHLVLGLALTSETQKETLTPSPQSNNVVDDHFALIRAISKKPYCEDGPSLTLALSSENCNLINQVPLDLSTQTSPLSTVSSFSSEGVKREREISSEELETTKIERVSSRVSGDEDEDATNSRKKLRLNKEQSNMLEESFKQHSTLNPKQKQALAKQLNLRARQVEVWFQNRRARYIHI*
• ORF Type: complete

Annotations of Ll_transcript_85774

• Blastp: Homeobox-leucine zipper protein HAT22 from Arabidopsis with 48.44% of identity
• Blastx: Homeobox-leucine zipper protein HAT22 from Arabidopsis with 48.44% of identity
• Eggnog: homeobox-leucine zipper protein(ENOG410Z2UE)
• Kegg: Link to kegg annotations (AT4G37790)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445952.1)
• Pfam: Homeobox domain (PF00046.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;