Protein coding transcript 219352

• Transcript: Ll_transcript_85275
• CDS coordinates: 1-315 (+)
• Peptide sequence: YILQYSEFFVAAQLGFPLAWKVVLVAQIVCWTGQLIGHGVFEKRAPALLDNLVQAFVMAPFFVLLEGLQTLFGYEPYPGFHAIVQAKIEADIKQWQESKQSLIS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_85275

• Blastp: Uncharacterized endoplasmic reticulum membrane protein C16E8.02 from Schizosaccharomyces with 46.05% of identity
• Blastx: Uncharacterized endoplasmic reticulum membrane protein C16E8.02 from Schizosaccharomyces with 46.05% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC16E8.02)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456214.1)
• Pfam: Protein of unknown function (DUF962) (PF06127.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;