Protein coding transcript 219543

• Transcript: Ll_transcript_190682
• CDS coordinates: 22-420 (+)
• Peptide sequence: MCFWYLCRQLIFSLARYEAVIDAYLDGLEASGLDDLSRVTSVASFFVSRVDTLIDQLLEKIGTPEALNLRGKAAVAQAALAFQLYQRKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLIGPDT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_190682

• Blastp: Transaldolase from Frankia with 62.2% of identity
• Blastx: Transaldolase from Acidothermus with 61.11% of identity
• Eggnog: Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway (By similarity)(COG0176)
• Kegg: Link to kegg annotations (Franean1_2074)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418668.1)
• Pfam: Transaldolase/Fructose-6-phosphate aldolase (PF00923.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;