| Transcript | Ll_transcript_189742 |
|---|---|
| CDS coordinates | 214-615 (+) |
| Peptide sequence | MGAIDFYSSSSFSMVKSNTNLQQLGFKHRPTTFSFDGNQRKNFVVMASTIPVEQVNKVPLQVKGDSFIREHLRKLAPYQPILPFEVLSSRLGRKPEDIVKLDANENPYGPPPEASYYYICLLVFSKLLSKSGR* |
| ORF Type | complete |
| Blastp | Histidinol-phosphate aminotransferase, chloroplastic from Nicotiana with 54.39% of identity |
|---|---|
| Blastx | Histidinol-phosphate aminotransferase, chloroplastic from Nicotiana with 83.47% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017410593.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer