Protein coding transcript 219601

• Transcript: Ll_transcript_189744
• CDS coordinates: 1-333 (+)
• Peptide sequence: VKLDANETPYGPPPEHSYGSQPLFIFRGLDIQFSYSYIYYSCVLDPGDKIVDCPPTFTMYEFDAELNGALVIKVPRKPDFSLNVEQITEVVKQEKPKCIFLTSPNNPDGR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_189744

• Blastp: Histidinol-phosphate aminotransferase, chloroplastic from Nicotiana with 57.78% of identity
• Blastx: Histidinol-phosphate aminotransferase, chloroplastic from Nicotiana with 55.17% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014624579.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;