Transcript | Ll_transcript_189720 |
---|---|
CDS coordinates | 147-548 (+) |
Peptide sequence | MGAIDFYSSSSFSMVKSNTNLQQLGFKHRPTTFSFDGNQRKNFVVMASTIPVEQVNKVPLQVKGDSFIREHLRKLAPYQPILPFEVLSSRLGRKPEDIVKLDANENPYGPPPEASYYYICLLVFSKLLSKSGR* |
ORF Type | complete |
Blastp | Histidinol-phosphate aminotransferase, chloroplastic from Nicotiana with 54.39% of identity |
---|---|
Blastx | Histidinol-phosphate aminotransferase, chloroplastic from Nicotiana with 83.47% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017410593.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer