Protein coding transcript 219609

• Transcript: Ll_transcript_189728
• CDS coordinates: 214-918 (+)
• Peptide sequence: MGAIDFYSSSSFSMVKSNTNLQQLGFKHRPTTFSFDGNQRKNFVVMASTIPVEQVNKVPLQVKGDSFIREHLRKLAPYQPILPFEVLSSRLGRKPEDIVKLDANENPYGPPPEVMVALGSIRFPYVYPDPESRRLRAALARDSGLESDYILAGCGADELIDLIMRCVLDPGDKIVDCPPTFTMYEFDAELNGALVIKVPRKPDFSLNVEQITEVVKQEKPKCIFLTSPNNPDGR*
• ORF Type: complete

Annotations of Ll_transcript_189728

• Blastp: Histidinol-phosphate aminotransferase, chloroplastic from Nicotiana with 69.96% of identity
• Blastx: Histidinol-phosphate aminotransferase, chloroplastic from Nicotiana with 74.07% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413939.1)
• Pfam: Aminotransferase class I and II (PF00155.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;