Protein coding transcript 219639

• Transcript: Ll_transcript_190372
• CDS coordinates: 184-1095 (+)
• Peptide sequence: MAFSDSNFLKNFWISDKILVPGFGFDNDEIDYDDDDDGPECPVLVFVNSRSGGQLGGNLLKTYRALLKEKQVFDLGDEAPDKVLSRIYSNLENLKLKGDEYAKKVIERLRLIVAGGDGTAGWLLGVVCDLKLSHPPPIATVPLGTGNNLPFAFGWGKKNPGTDESSVMSFLDQVMKAKEMKIDNWHILMRMRAPKEGLCDPIAPLELPHSLHAFHRLSEADELNVEGCHTFRGGFWNYFSMGMDAQVSYAFHSERKLHPEKFKNQLINQSTYAKLGCTQGWFCAHLFHPPSRSGHVDLSMIGK*
• ORF Type: complete

Annotations of Ll_transcript_190372

• Blastp: Diacylglycerol kinase 5 from Arabidopsis with 73.2% of identity
• Blastx: Diacylglycerol kinase 5 from Arabidopsis with 73.36% of identity
• Eggnog: DiacylGlycerol Kinase(ENOG410XQVB)
• Kegg: Link to kegg annotations (AT2G20900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437038.1)
• Pfam: Diacylglycerol kinase catalytic domain (PF00781.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;