| Transcript | Ll_transcript_187818 |
|---|---|
| CDS coordinates | 82-483 (+) |
| Peptide sequence | MKKIVIQVHMEREKCRSKAMQIAAAFQGVSSVSLEGERRNQVVVTGNGIDSVCLTSKLRKKFPYATLISVEDVIVNPTSNEGEHNNSGGGGQISETENVLVPYCNNHWNYPPQYPMYQVVYDSYPTHNGCFIL* |
| ORF Type | complete |
| Blastp | Heavy metal-associated isoprenylated plant protein 47 from Arabidopsis with 36.72% of identity |
|---|---|
| Blastx | Purine permease 1 from Arabidopsis with 57.38% of identity |
| Eggnog | NA(ENOG4110725) |
| Kegg | Link to kegg annotations (AT3G20180) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019460871.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer