Protein coding transcript 219666

• Transcript: Ll_transcript_187821
• CDS coordinates: 82-483 (+)
• Peptide sequence: MKKIVIQVHMEREKCRSKAMQIAAAFQGVSSVSLEGERRNQVVVTGNGIDSVCLTSKLRKKFPYATLISVEDVIVNPTSNEGEHNNSGGGGQISETENVLVPYCNNHWNYPPQYPMYQVVYDSYPTHNGCFIL*
• ORF Type: complete

Annotations of Ll_transcript_187821

• Blastp: Heavy metal-associated isoprenylated plant protein 47 from Arabidopsis with 36.72% of identity
• Blastx: Heavy metal-associated isoprenylated plant protein 47 from Arabidopsis with 48.53% of identity
• Eggnog: NA(ENOG4110725)
• Kegg: Link to kegg annotations (AT3G20180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417339.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;