Protein coding transcript 219707

• Transcript: Ll_transcript_189968
• CDS coordinates: 1-633 (+)
• Peptide sequence: KAFIDHFDIFVDPLCRSYLTFYVLICCYYNYISWKCYLSQHLAQKNPSLLSKPGVRLLVLEILNYRLLPLYRYEGKTKSLMYDVTKIISALKGKRGDHRVFRLAENLCLNLIFSLRDFFMIKREGKGPTEFTETLNRVTVITLAILIKTCGIANVEHMLYLRTMLEQILSTSTHTWSEKTLRYFPSVLREALGGLLIDKRSLAIQAWQQL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_189968

• Blastp: Mediator of RNA polymerase II transcription subunit 23 from Arabidopsis with 77.84% of identity
• Blastx: Mediator of RNA polymerase II transcription subunit 23 from Arabidopsis with 69.9% of identity
• Eggnog: Mediator complex subunit 23(ENOG410ZH5R)
• Kegg: Link to kegg annotations (AT1G23230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424087.1)
• Pfam: Mediator complex subunit 23 (PF11573.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;