Protein coding transcript 219839

• Transcript: Ll_transcript_188174
• CDS coordinates: 566-1258 (+)
• Peptide sequence: MFADLGHFSQLSIQIAFTSVVYPSLILAYMGQAAYLTRHHDVQNDRHFGFYISVPEKLRLPVFVIAILAAVVGSQAIITGTFSIIKQCSALSCFPRVKVVHTSSKIHGQIYIPEVNWLLMLLCLAVTIGFRDTKHMGNATGLAVITVMLVTTSLMSLVIVLCWHKNVLLALGFVFVFGTIEALFFSASLIKFLEGAWVPVALAFVFHTVMYVWHYGTLKKYQFDVENKVSI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_188174

• Blastp: Potassium transporter 10 from Oryza sativa with 77.49% of identity
• Blastx: Potassium transporter 6 from Arabidopsis with 80.08% of identity
• Eggnog: Transport of potassium into the cell (By similarity)(COG3158)
• Kegg: Link to kegg annotations (4341573)
• CantataDB: Link to cantataDB annotations (CNT0000674)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423928.1)
• Pfam: K+ potassium transporter (PF02705.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;