Transcript | Ll_transcript_188182 |
---|---|
CDS coordinates | 104-490 (+) |
Peptide sequence | MGQAAYLSRHHHVQYEHHFGFYVSVPEKLRVPVLVIAILAAVVGSQAIITGIFSIIKQCSALSCFPRVKVVHTSSKIHGQIYIPEINWLLMLLCLAVTIGFRDTKHMGNAAGLAVITVMLVTTCLMSLV |
ORF Type | 3prime_partial |
Blastp | Potassium transporter 6 from Arabidopsis with 85.27% of identity |
---|---|
Blastx | Potassium transporter 6 from Arabidopsis with 84.83% of identity |
Eggnog | Transport of potassium into the cell (By similarity)(COG3158) |
Kegg | Link to kegg annotations (AT1G70300) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019423928.1) |
Pfam | K+ potassium transporter (PF02705.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer