| Transcript | Ll_transcript_188135 |
|---|---|
| CDS coordinates | 1-348 (+) |
| Peptide sequence | LEQALGGGEPIKFGSHGDESAKGDGNNVSDANVPKDAVEEWPAPKQIHSFYFVRCRPYDDPNIKSKVEYLEKELNKKSQARFQVTERLKAKRVSCELFIMVACLKFNCFSGVQNR* |
| ORF Type | 5prime_partial |
| Blastp | Proton pump-interactor 1 from Arabidopsis with 46.3% of identity |
|---|---|
| Blastx | Proton pump-interactor 1 from Arabidopsis with 53.68% of identity |
| Eggnog | proton pump interactor(ENOG4111QP9) |
| Kegg | Link to kegg annotations (AT4G27500) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019443948.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer