Transcript | Ll_transcript_188135 |
---|---|
CDS coordinates | 1-348 (+) |
Peptide sequence | LEQALGGGEPIKFGSHGDESAKGDGNNVSDANVPKDAVEEWPAPKQIHSFYFVRCRPYDDPNIKSKVEYLEKELNKKSQARFQVTERLKAKRVSCELFIMVACLKFNCFSGVQNR* |
ORF Type | 5prime_partial |
Blastp | Proton pump-interactor 1 from Arabidopsis with 46.3% of identity |
---|---|
Blastx | Proton pump-interactor 1 from Arabidopsis with 53.68% of identity |
Eggnog | proton pump interactor(ENOG4111QP9) |
Kegg | Link to kegg annotations (AT4G27500) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443948.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer