Protein coding transcript 219859

• Transcript: Ll_transcript_188137
• CDS coordinates: 120-707 (+)
• Peptide sequence: MALEIAGFEVVQGPVENDAERVKSVLHEKDNGKLEQAQGVGEPIIFGSHGDESAKGDVKEASDATVPKDAVEEWPAPKQIHSFYFVRCRPYDDPNIKSKIDQIDKEMNKKSQARFQVTEALKAKRSERAELISQVKSLNGDRRQYQSTVDEKLREIGPLQQAPGKLRTANNAGRGGLCSSEEELNDAIYSLQYRIQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_188137

• Blastp: Proton pump-interactor 1 from Arabidopsis with 46.57% of identity
• Blastx: Proton pump-interactor 1 from Arabidopsis with 46.57% of identity
• Eggnog: proton pump interactor(ENOG4111QP9)
• Kegg: Link to kegg annotations (AT4G27500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425813.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;