Protein coding transcript 219877

• Transcript: Ll_transcript_188132
• CDS coordinates: 1632-2747 (+)
• Peptide sequence: MGGDLSGVMKEKHAVAAKIKIIDKELETIDKDIQVLQDELNAITVKKDEDFESIQKLRKQRDEGNGYFYQSRQLLNKAKELAAKKDITALEELAQTEVEKFLSLWNSDKTFRNDYEKRILTSLDMRQLSRDGRIRNPNEKPLVEVPKPAEAVALKKATPKQPKEEPKPSPPVTLPTPVVEKESKNKGKDSKSKPDSKDLGEADEFEFENPHKEIPIKKPELDPTKLKEIKREEEIAKQKLALERKKKLAEKAAIKAAQRAQKEAEKKLKDREKKAKKKTSGTATVPDAEEPEEAVVDAPEPEKVDDDIEPAAPVKEKVPKAGIRSRSRAVGPAPIQKAILKRKKSNNYWVWAAAAASLVLILLVLGYTQLF*
• ORF Type: complete

Annotations of Ll_transcript_188132

• Blastp: Proton pump-interactor BIP103 from Oryza sativa with 45% of identity
• Blastx: Proton pump-interactor 1 from Arabidopsis with 57.78% of identity
• Eggnog: proton pump interactor(ENOG4111QP9)
• Kegg: Link to kegg annotations (4346802)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443948.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;