Transcript | Ll_transcript_188046 |
---|---|
CDS coordinates | 94-726 (+) |
Peptide sequence | MACNGDGCQSTCYKDEQPCSKPIESPNLISKICIKCKLNDAVSGYGGVDDGRFCADCFRSNLFGKFRLAVTSNAMITPTDKVLVAFSGGPSSRVALQFVHDMQERAQKNFDASRDRSLPVFGVGVVFIDESAILSIPSGEMEEAVEVISSVVSSLAPPTKELHIVPVENVYSSDSSDGKEKLIKLVGSVSDPTGREDMLLYLRMLALQKV* |
ORF Type | complete |
Blastp | Cytoplasmic tRNA 2-thiolation protein 2 from Arabidopsis with 58.33% of identity |
---|---|
Blastx | Cytoplasmic tRNA 2-thiolation protein 2 from Arabidopsis with 55.24% of identity |
Eggnog | Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). May act by forming a heterodimer with NCS6 that ligates sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position. Prior mcm(5) tRNA modification by the elongator complex is required for 2-thiolation. May also be involved in protein urmylation (By similarity)(ENOG410YGU3) |
Kegg | Link to kegg annotations (AT4G35910) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444040.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer