Protein coding transcript 219899

• Transcript: Ll_transcript_188051
• CDS coordinates: 94-948 (+)
• Peptide sequence: MACNGDGCQSTCYKDEQPCSKPIESPNLISKICIKCKLNDAVSGYGGVDDGRFCADCFRSNLFGKFRLAVTSNAMITPTDKVLVAFSGGPSSRVALQFVHDMQERAQKNFDASRDRSLPVFGVGVVFIDESAILSIPSGEMEEAVEVISSVVSSLAPPTKELHIVPVENVYSSDSSDGKEKLIKLVGSVSDPTGREDMLLYLRMLALQKVASEFGYNRLIVGSCVSRIASHVISATVKGQGYSLPADIQYVDARWEIPVVLPLRDCFAQEINMFCHLDGLVLPS*
• ORF Type: complete

Annotations of Ll_transcript_188051

• Blastp: Cytoplasmic tRNA 2-thiolation protein 2 from Arabidopsis with 61.54% of identity
• Blastx: Cytoplasmic tRNA 2-thiolation protein 2 from Arabidopsis with 61.54% of identity
• Eggnog: Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). May act by forming a heterodimer with NCS6 that ligates sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position. Prior mcm(5) tRNA modification by the elongator complex is required for 2-thiolation. May also be involved in protein urmylation (By similarity)(ENOG410YGU3)
• Kegg: Link to kegg annotations (AT4G35910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444040.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;