Transcript | Ll_transcript_189033 |
---|---|
CDS coordinates | 967-1509 (+) |
Peptide sequence | MRIGTNHGSLSDRIMSYYGDSPRGMVESAFEFARICRKLDFHNFVFSMKASNPVIMVQAYRTLLAEMLVQGWDYPLHLGVTEAGEGEDGRMKSAIGIGTLLQDGLGDTIRVSLTEPPEEEIDPCRRLANLGMRASELQKGVAPFEEKHRHYFDFQRRTGQLPVQKEGEEVDYRGALHRDGS |
ORF Type | 3prime_partial |
Blastp | 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic from Arabidopsis with 92.82% of identity |
---|---|
Blastx | 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic from Arabidopsis with 91.44% of identity |
Eggnog | 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase activity(COG0821) |
Kegg | Link to kegg annotations (AT5G60600) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447881.1) |
Pfam | GcpE protein (PF04551.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer