Protein coding transcript 219944

• Transcript: Ll_transcript_189034
• CDS coordinates: 103-999 (+)
• Peptide sequence: MLFMFPTLSSYNIPLVADIHFAPAIALRVAECFDKIRVNPGNFADRRAQFEKLEYTEEDYQKELEHIEQVFTPLVEKCKKYGRAIRIGTNHGSLSDRIMSYYGDSPRGMVESAFEFARICRKLDFHNFVFSMKASNPVVMVQAYRLLLSEMYVQGWDYPLHLGVTEAGEGEDGRMKSAIGIGALLQDGLGDTIRVSLTEPPEEEIDPCRRLANLGMGASKLEKGVAPFEEKHRRYFDFQRRSGQLPVQKEGEEVDYRGALHRDGSVLMSVSLDQLKKPELLYKSLAAKLIVGMPFKVS*
• ORF Type: complete

Annotations of Ll_transcript_189034

• Blastp: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic from Arabidopsis with 89.2% of identity
• Blastx: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (ferredoxin), chloroplastic from Oryza sativa with 83.03% of identity
• Eggnog: 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase activity(COG0821)
• Kegg: Link to kegg annotations (AT5G60600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448725.1)
• Pfam: GcpE protein (PF04551.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;