Transcript | Ll_transcript_189385 |
---|---|
CDS coordinates | 215-745 (+) |
Peptide sequence | MIDDLSCIENQHKAFYFYSENPCSNTHRGSQEDLEASKSVPYNSNSSDLDIESNRDETMHEQSSLEESILQNLEMAIAQFNGKTRICFRDALYRLAKDTKQQHLVENLDGGLNMQESMPHEVLNETMRPEDKEPMKSDTNNVDRAVANLMFHKMEINMQDLSLTISVNSNQEVNGT* |
ORF Type | complete |
Blastp | Protein LNK3 from Arabidopsis with 38.21% of identity |
---|---|
Blastx | Protein LNK3 from Arabidopsis with 38.21% of identity |
Eggnog | NA(ENOG410Z9PA) |
Kegg | Link to kegg annotations (AT3G12320) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449993.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer