Protein coding transcript 219980

• Transcript: Ll_transcript_189378
• CDS coordinates: 2057-2407 (+)
• Peptide sequence: MHEQYSNEESILQNLEMAIAQFTGKTRICFRDALYRLARDTKHVVENLDGGLNMQTTVLGEVTNETMRSEDNETMESDTNSVDRAVANLVFNKMETNIQDLPLTTSIKSNQEINVT*
• ORF Type: complete

Annotations of Ll_transcript_189378

• Blastp: Protein LNK3 from Arabidopsis with 43.4% of identity
• Blastx: Protein LNK3 from Arabidopsis with 43.4% of identity
• Eggnog: NA(ENOG410Z9PA)
• Kegg: Link to kegg annotations (AT3G12320)
• CantataDB: Link to cantataDB annotations (CNT0002100)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434721.1)
• Pfam: -
• Rfam: SSU_rRNA_archaea (RF01959)
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;