| Transcript | Ll_transcript_190538 |
|---|---|
| CDS coordinates | 1515-1829 (+) |
| Peptide sequence | MIAALKSNLEQVYAQSRDSKEGCGDSEVDDTASCVIGGTIDFHLLSKGNKDMKEMMTCKACKVNEVNMLLLPCKHLCLCKDCESKLSYCPLCQSSKFIGMEVYM* |
| ORF Type | complete |
| Blastp | Probable BOI-related E3 ubiquitin-protein ligase 3 from Arabidopsis with 33.91% of identity |
|---|---|
| Blastx | - |
| Eggnog | protein binding zinc ion binding(ENOG4111S1X) |
| Kegg | Link to kegg annotations (AT3G12920) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019414810.1) |
| Pfam | Zinc finger, C3HC4 type (RING finger) (PF13920.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer