| Transcript | Ll_transcript_352590 |
|---|---|
| CDS coordinates | 2-337 (+) |
| Peptide sequence | PCTAEKEVIVVAEVLPQLMTAMTANGAQVVSDPEELAKLRSLLLDTSGTRPNTAWVGQDAQKILRTAGIEPHQDTRLVTMVTDPSDPFVQVEMLMPVVPVVPVTDYLTAIDL |
| ORF Type | internal |
| Blastp | Ethanolamine utilization protein EutE from Escherichia with 37.39% of identity |
|---|---|
| Blastx | - |
| Eggnog | Dehydrogenase(COG1012) |
| Kegg | Link to kegg annotations (JW2439) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_007161802.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer