Transcript | Ll_transcript_352590 |
---|---|
CDS coordinates | 2-337 (+) |
Peptide sequence | PCTAEKEVIVVAEVLPQLMTAMTANGAQVVSDPEELAKLRSLLLDTSGTRPNTAWVGQDAQKILRTAGIEPHQDTRLVTMVTDPSDPFVQVEMLMPVVPVVPVTDYLTAIDL |
ORF Type | internal |
Blastp | Ethanolamine utilization protein EutE from Escherichia with 37.39% of identity |
---|---|
Blastx | - |
Eggnog | Dehydrogenase(COG1012) |
Kegg | Link to kegg annotations (JW2439) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_007161802.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer