Protein coding transcript 220054

• Transcript: Ll_transcript_188395
• CDS coordinates: 78-563 (+)
• Peptide sequence: MGLSDLCVFHVILVSVMLFVLWGLIVLMGLVQVRIQLGQGSAAHVTTTMLKNEGVAAFYKGLSAGLLRQATYTTARLGSFRILTNKAIEANDGKPLPLYQKALCGLTAGAIGATVGSPSDLALIRMQADATLPAAQRRHYTNAFHALFRITKDEAVLSLWKG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_188395

• Blastp: Mitochondrial dicarboxylate/tricarboxylate transporter DTC from Arabidopsis with 81.29% of identity
• Blastx: Mitochondrial dicarboxylate/tricarboxylate transporter DTC from Arabidopsis with 81.29% of identity
• Eggnog: Mitochondrial(ENOG410XQHU)
• Kegg: Link to kegg annotations (AT5G19760)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461049.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;