Protein coding transcript 220070

• Transcript: Ll_transcript_188922
• CDS coordinates: 1196-1558 (+)
• Peptide sequence: MFGPVSGKDGWKDLTFMYDKVRIRDEAICSSFLHIFETEGCKMLHMSCEEHDKLAAKSQFITHTIGRTLGEMDIKSTPIDTKGFQTLVQLLENLEHGLHKVKEMLVRGATEEQGIEKAER*
• ORF Type: complete

Annotations of Ll_transcript_188922

• Blastp: Arogenate dehydrogenase 1, chloroplastic from Arabidopsis with 59.79% of identity
• Blastx: Arogenate dehydrogenase 1, chloroplastic from Arabidopsis with 61.26% of identity
• Eggnog: prephenate dehydrogenase(COG0287)
• Kegg: Link to kegg annotations (AT5G34930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454748.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;