Protein coding transcript 220072

• Transcript: Ll_transcript_188928
• CDS coordinates: 691-1128 (+)
• Peptide sequence: MFGPVSGKDGWKDLTFMYDKVRIRDEAICSSFLHIFETEGCKMLHMSCEEHDKLAAKSQFITHTIGRTLGEMDIKSTPIDTKGFQTLVQLKETTIRDSFDLYSGLFLHNRFAKQELENLEHGLHKVKEMLVRGATEEQGIEKAER*
• ORF Type: complete

Annotations of Ll_transcript_188928

• Blastp: Arogenate dehydrogenase 1, chloroplastic from Arabidopsis with 55.22% of identity
• Blastx: Arogenate dehydrogenase 1, chloroplastic from Arabidopsis with 56.76% of identity
• Eggnog: prephenate dehydrogenase(COG0287)
• Kegg: Link to kegg annotations (AT5G34930)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454748.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;