Transcript | Ll_transcript_189758 |
---|---|
CDS coordinates | 186-1088 (+) |
Peptide sequence | MTIDCKTSMHSFIMPQQPPRQESKEEEVQALVFDGSVLRHQLHLPKQFIWPDEEKACLDVPELQVPLIDLGGFLSGDPLASLQASRLVGEACLKHGFFLVVNHGIHNELISNAHLHMDEFFELPLFQKQRAQRKLGEHCGYASSFTGRFSSKLPWKETLSFQFSAHKNSPNLVQDYLCNTMGKDFDQSGKVYQDYCEAMNTLSLGIMELLGMSLGVGKTCFREFFEENNSIMRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDQVGGLQVFVDNQWHSISPNPNAFVVNIGDTFMVSYY* |
ORF Type | complete |
Blastp | Gibberellin 20 oxidase 2 from Arabidopsis with 63.64% of identity |
---|---|
Blastx | Gibberellin 20 oxidase 2 from Arabidopsis with 63.64% of identity |
Eggnog | 2OGFe(II) oxygenase(COG3491) |
Kegg | Link to kegg annotations (AT5G51810) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019442170.1) |
Pfam | non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer