Protein coding transcript 220129

• Transcript: Ll_transcript_189760
• CDS coordinates: 284-841 (+)
• Peptide sequence: MNTLSLGIMELLGMSLGVGKTCFREFFEENNSIMRLNYYPPCQKPELTLGTGPHCDPTSLTILHQDQVGGLQVFVDNQWHSISPNPNAFVVNIGDTFMALSNGRYKSCLHRAVVNNKITRKSLAFFLCPRSDKVVSPPCELVDNYSPRLYPDFTWPMLLEFTQKHYRADMKTLGAFTNWLQLKSS*
• ORF Type: complete

Annotations of Ll_transcript_189760

• Blastp: Gibberellin 20 oxidase 1 from Arabidopsis with 78.33% of identity
• Blastx: Gibberellin 20 oxidase 1 from Arabidopsis with 78.01% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT4G25420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442170.1)
• Pfam: 2OG-Fe(II) oxygenase superfamily (PF03171.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;