Transcript | Ll_transcript_320496 |
---|---|
CDS coordinates | 100-1263 (+) |
Peptide sequence | MAPKRVLLLCGDFMEDYEVMVPFQALQAYGLTVDAVCPGKKAGDVCRTAVHQLSGHQTYSETRGHNFELNATFDDVDATSYDGLVLPGGRAPEYLAHIPGVVELVTKFATSGKALASICHGQLILAAAGVVKGRKCTAFPAVRPALVASGAHWVEPDTNSATVVDGNLITAATYEGHPEFIRHFVKALGGNISGSDKKILFLCGDYMEDYEVTVPFQSLQALGCHVDAVCPKKKAGETCPTAIHDFEGDQTYSEKPGHDFALTATYSDVDVSSYDALVIPGGRAPEYLALDESVIALVKHFIESKKPVASICHGQQILAAADVLKGRKCTAFPAVKLNVVLAGATWLEPDPISRCFTDGNLVTGAAWPGHPEFISQLMVLLGIKVSF* |
ORF Type | complete |
Blastp | Protein DJ-1 homolog D from Arabidopsis with 78.09% of identity |
---|---|
Blastx | Protein DJ-1 homolog D from Arabidopsis with 78.09% of identity |
Eggnog | PfpI family(COG0693) |
Kegg | Link to kegg annotations (AT3G02720) |
CantataDB | Link to cantataDB annotations (CNT0001920) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439532.1) |
Pfam | DJ-1/PfpI family (PF01965.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer